williamspaniel.com | William Spaniel | Assistant Professor, Department of Political Science, University of

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔
# If you are regularly crawling WordPress.com sites, please use our firehose to receive real-time push updates instead. # Please see https://developer.wordpress.com/docs/firehose/ for more details. Sitemap: https://williamspaniel.com/sitemap.xml Sitemap: https://williamspaniel.com/news-sitemap.xml User-agent: * Disallow: /wp-admin/ Allow: /wp-admin/admin-ajax.php Disallow: /wp-login.php Disallow: /wp-signup.php Disallow: /press-this.php Disallow: /remote-login.php Disallow: /activate/ Disallow: /cgi-bin/ Disallow: /mshots/v1/ Disallow: /next/ Disallow: /public.api/ # This file was generated on Wed, 01 Feb 2023 05:06:25

Meta Tags

Title	William Spaniel \| Assistant Professor, Department of Political Science, University of
Description	Assistant Professor, Department of Political Science, University of
Keywords	N/A

Server Information

WebSite	williamspaniel.com
Host IP	192.0.78.25
Location	United States

Related Websites

                        Site
                        Rank
                    

More to Explore

willowbathandvanity.com

willowcreekcounselingky.com

windshieldreplacementmckinney.com

windsormeade.org

wineclubgroup.com

wineglassnecklace.com

wingsovercamarillo.com

winnerscircletrailers.com

wiresdonttalktheband.com

wisaal.com

williamspaniel.com Valuation

US$6,272,805

Last updated: 2023-05-08 15:25:30

williamspaniel.com has Semrush global rank of 1,687,332. williamspaniel.com has an estimated worth of US$ 6,272,805, based on its estimated Ads revenue. williamspaniel.com receives approximately 723,786 unique visitors each day. Its web server is located in United States, with IP address 192.0.78.25. According to SiteAdvisor, williamspaniel.com is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$6,272,805
Daily Ads Revenue	US$5,791
Monthly Ads Revenue	US$173,709
Yearly Ads Revenue	US$2,084,502
Daily Unique Visitors	48,253
Note: All traffic and earnings values are estimates.

DNS Records

Host	Type	TTL	Data
williamspaniel.com.	A	299	IP: 192.0.78.25
williamspaniel.com.	A	299	IP: 192.0.78.24
williamspaniel.com.	NS	86400	NS Record: ns2.wordpress.com.
williamspaniel.com.	NS	86400	NS Record: ns3.wordpress.com.
williamspaniel.com.	NS	86400	NS Record: ns1.wordpress.com.

HtmlToTextCheckTime:2023-05-08 15:25:30

Menu Skip to primary content Classes CV Game Theory Calculator Papers Textbook YouTube Search William Spaniel Assistant Professor, Department of Political Science, University of Pittsburgh Welcome! Featured I am a political scientist who studies war, nuclear proliferation, and terrorism (mostly) using formal models. Currently, I am an assistant professor in the University of Pittsburgh’s Department of Political Science. Before that, I was a Stanton Nuclear Security Postdoctoral Fellow at Stanford’s Center for International Security and Cooperation. I received a PhD from the University of Rochester in 2015. If you want to know more, you can check my CV page . You can also email me at williamspaniel@gmail.com . August 27, 2014 6 Replies Let’s Temper Expectations with Iran US and Iran diplomatic teams negotiating the nuclear deal’s implementation in 2016 Recently, some commentators have suggested that the Biden administration use Trump’s withdrawal from the Joint Comprehensive Plan of

HTTP Headers

HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Sat, 30 Oct 2021 06:51:06 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://williamspaniel.com/
X-ac: 2.mdw _dca 

HTTP/2 200 
server: nginx
date: Sat, 30 Oct 2021 06:51:06 GMT
content-type: text/html; charset=UTF-8
strict-transport-security: max-age=31536000
vary: Accept-Encoding
vary: Cookie
x-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
host-header: WordPress.com
link: ; rel=shortlink
x-ac: 2.mdw _dca

williamspaniel.com Whois Information

Domain Name: WILLIAMSPANIEL.COM
Registry Domain ID: 1867342500_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.wildwestdomains.com
Registrar URL: http://www.wildwestdomains.com
Updated Date: 2021-06-16T10:06:28Z
Creation Date: 2014-07-17T20:41:47Z
Registry Expiry Date: 2022-07-17T20:41:47Z
Registrar: Wild West Domains, LLC
Registrar IANA ID: 440
Registrar Abuse Contact Email: abuse@wildwestdomains.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
DNSSEC: unsigned
>>> Last update of whois database: 2021-09-17T17:36:04Z <<<

williamspaniel.com valuation and analysis